domain length restriction for seo/niche marketing?

N

nobodyhome

New member
Apr 14, 2010
15
0
0
hey guys, another noob question...

i've decided to play my hand at some niche SEO, just for fun. also to try to set up some commercial properties for myself.

i'm new to this and not sure how it all works - there's supposed to be a huge advantage if you can get the exact keyword you're targeting in the URL right? i've heard stories of people barely having to do any SEO work at all just because they got that exact match keyword.

so my question is, is there any restriction on the domain length before this trick stops working? so let's say one of the keywords i find is "how to make monies online without getting meatspinned at wickedfire". let's say this keyword gets 1,000,000 searches a month and competition is low-moderate. and most importantly, let's say that the domain "howtomakemoniesonlinewithoutgettingmeatspinnedatwickedfire.com" is free.

so for a domain like that, does the absurd length of the domain, in google's eyes, outweigh the exact phrase match? keep in mind i don't give a damn about brandability here, my entire goal is just to pull visitors off of the serps.

thoughts?
 


nobodyhome said:
so for a domain like that, does the absurd length of the domain, in google's eyes, outweigh the exact phrase match? keep in mind i don't give a damn about brandability here, my entire goal is just to pull visitors off of the serps.

thoughts?
Click to expand...

If you don't care about brandability, use a shorter domain name with hyphens
 
^^ fuck I thought I almost got dick-rolled and closed the window, thanks for the link.
 
Clyde there is a no dickroll protocol here in the newbie section -- btw you should really check out the other link in my orig post "the moterfuckin seo thread" (something like that-- like I said the link is in my post) really priceless shit -- dickroll safe too - I promise.
 
Domain name match helps for SEO and helps CTR from results (since Google bolds anything that matches the search), but it won't allow you to "barely do any seo work."

I don't think there is a length restriction, but I'd avoid really long URLs since they look suspicious / spammy to users.

Also, the longer the phrase is, the less likely people will be running that phrase as a search. Most search engine users are lazy and type 1-2 words, when you get to 3+ the number of searches for most topics drops off significantly.

check Search-based keyword tool

--David
 
You must log in or register to reply here.
Top Bottom